General Information

  • ID:  hor001152
  • Uniprot ID:  P41854
  • Protein name:  Neuropeptide AF3
  • Gene name:  AFP-1
  • Organism:  Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ascaris (genus), Ascarididae (family), Ascaridoidea (superfamily), Ascaridomorpha (infraorder), Spirurina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ENEKKAVPGVLRF
  • Length:  13
  • Propeptide:  MVELAAIAVHLFAILCISVSAEIELPDKRAQFDDSFLPYYPSSAFMDSDEAIVAVPSSKPGRYYFDQVGLDAENAMSAREKRGFGDEMSMPGVLRFGKRGMPGVLRFGKRENEKKAVPGVLRFGKRGDVPGVLRFGKRSDMPGVLRFGKRSMPGVLRFGRR
  • Signal peptide:  MVELAAIAVHLFAILCISVSA
  • Modification:  T13 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P41854-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001152_AF2.pdbhor001152_ESM.pdb

Physical Information

Mass: 170095 Formula: C67H111N19O19
Absent amino acids: CDHIMQSTWY Common amino acids: EKV
pI: 9.53 Basic residues: 3
Polar residues: 2 Hydrophobic residues: 5
Hydrophobicity: -61.54 Boman Index: -2755
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 82.31
Instability Index: 3886.15 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21524146
  • Title:  Discovery of Neuropeptides in the Nematode Ascaris Suum by Database Mining and Tandem Mass Spectrometry